PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa09g081060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family Nin-like
Protein Properties Length: 828aa    MW: 92471.6 Da    PI: 6.1187
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa09g081060.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK93.71.3e-29555606152
          RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     aek+i+l++l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  Csa09g081060.1 555 AEKNITLDVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGIQRWPSRKIKKV 606
                     589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.2545626IPR003035RWP-RK domain
PfamPF020421.3E-25558606IPR003035RWP-RK domain
SuperFamilySSF542771.3E-22718815No hitNo description
PROSITE profilePS5174525.729729812IPR000270PB1 domain
SMARTSM006661.4E-23729812IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2402.5E-19730809No hitNo description
PfamPF005643.7E-17731810IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 828 aa     Download sequence    Send to blast
MENNSLPLDP AMDSSFMDGL LLEGCWLETT DAASELFNFS PSTSVTPFDP SSFMWSPTQQ  60
DTAAAAISSS HSFSQTMYGQ DCAERSSLED QGRDLSSFNR RWWIGPSGHG SSVMERLVQA  120
VAHIKDYTSE RGSLIQLWVP VDRGGKRVLT TKEQPFSHDP MCQRLAHYRE ISVNYQFSTE  180
QEDSGSNNSN DLVGLPGRVF LGKVPEWTPD VRFFKNEEYP RVQHAQDCDV RGTLAIPVFE  240
QGSQNCLGVI EVVMTTQMVK LSPDLESICR ALQAVDLRST GVPIPPSLKE PDFSYQAALP  300
EIRNLLRCAC ETHKLPLAQT WVSCLKQSKT GCRHNDENYI HCVSTIDDAC YVGDPTVREF  360
HEACSEHHLL KGQGVVGEAF LTNGPCFSSD VSSYKKSEYP LSHHATMFGL HGTVAIRLRC  420
IHTGSADFVL EFFLPKSCRD IEEQRKMLNA LSTIMAHVPR SLRTVTEKEL EEEGNPMARE  480
VIERGVTLPK IENTSEVQES NSNPQNAGLV FDGGTTEMGE LGSDYGKGLS VNEKSTFSSA  540
TGGFSRITEK KRTKAEKNIT LDVLRQYFAG SLKDAAKSIG VCPTTLKRIC RQHGIQRWPS  600
RKIKKVGHSL QKIQRVIDSV EGVSGHHLPI GSFYANFPNL ASSPEASSLQ QQQQQSKRTT  660
FLFSSTSQPT KSPGSSCSYS SSCSSETQVN KEDPTDKTRQ ETMTLSRSFK ERQTTTHLSP  720
SSSSQEDDLL RIKVTYEEEK IRFRMRNSHR LNDLLWEIAK RFSIEDVSRY DLKYLDEDNE  780
WVLLRCDDDV DECVDVCRSF PGQTIKLLLQ LSSQYLSERS SASGCPS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4935370.0AB493537.1 Arabidopsis thaliana At1g76350 mRNA for hypothetical protein, partial cds, clone: RAAt1g76350.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010428689.10.0PREDICTED: protein NLP5-like
RefseqXP_010428691.10.0PREDICTED: protein NLP5-like
RefseqXP_010428692.10.0PREDICTED: protein NLP5-like
SwissprotQ9SFW80.0NLP5_ARATH; Protein NLP5
TrEMBLR0I6G00.0R0I6G0_9BRAS; Uncharacterized protein
STRINGAT1G76350.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34612663
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76350.10.0Nin-like family protein